General Information

  • ID:  hor000053
  • Uniprot ID:  Q95J46
  • Protein name:  Urotensin II
  • Gene name:  UTS2
  • Organism:  Sus scrofa (Pig)
  • Family:  Urotensin-2 family
  • Source:  Animal
  • Expression:  spinal cord
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  GPPSECFWKYCV
  • Length:  12(110-121)
  • Propeptide:  MSKLVPCLLLLGCLGLLFALPVPDSRKEPLPFSAPEDVRSAWDELERASLLQMLPETPGAEAGEDLREADAGMDIFYPRGEMRKAFSGQDPNIFLSHLLARIKKPYKKRGPPSECFWKYCV
  • Signal peptide:  MSKLVPCLLLLGCLGLLFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  evoked a release of arachidonic acid metabolites
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  1 nM
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-Q95J46-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000053_AF2.pdbhor000053_ESM.pdb

Physical Information

Mass: 161202 Formula: C66H90N14O17S2
Absent amino acids: ADHILMNQRT Common amino acids: CP
pI: 6.13 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: -16.67 Boman Index: -305
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 24.17
Instability Index: 8765 Extinction Coefficient cystines: 7115
Absorbance 280nm: 646.82

Literature

  • PubMed ID:  10548501
  • Title:  Urotensin II Is the Endogenous Ligand of a G-protein-coupled Orphan Receptor, SENR (GPR14)